method validation comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-10-05. Numbers and descriptions here follow the published literature rather than marketing material.
Reverse-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. It separates components by hydrophobicity on a column with a water-organic mobile phase. Ultraviolet absorbance at 214 nm or 220 nm detects peptide bonds. The main peak area as a percentage of total peak area gives a purity figure. This figure depends on column, gradient, wavelength, and how peaks are integrated, so it is method-specific rather than absolute.
Mass spectrometry provides complementary information by measuring molecular mass. Electrospray ionization or matrix-assisted laser desorption/ionization can confirm the expected peptide mass and reveal related impurities with different masses. It does not directly quantify all species because ionization efficiency varies. When coupled to liquid chromatography, LC-MS can assign masses to chromatographic peaks. This helps distinguish target peptide from truncation, oxidation, or deletion products. Mass accuracy and resolution determine how confidently a mass can be matched to a proposed structure.
Other methods address specific purity concerns. Amino acid analysis gives compositional data after hydrolysis, while capillary electrophoresis separates by charge-to-mass ratio. Karl Fischer titration measures residual water, and gas chromatography can detect residual solvents. Nuclear magnetic resonance can identify organic impurities but is less sensitive for trace levels. No single test covers all possible impurities, so purity testing usually combines orthogonal methods and reports the conditions used. The choice of methods is guided by the impurity classes of interest.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
| Property | Value | Notes |
|---|---|---|
| Typical analytical method | RP-HPLC with UV detection | Separates by hydrophobicity; purity is method-dependent |
| Confirmatory method | LC-MS or MALDI-TOF MS | Provides molecular mass and impurity mass information |
| Common detection wavelength | 214 nm or 220 nm | Peptide bond absorbance; also 280 nm for aromatic residues |
| Typical purity specification | 95% or greater by HPLC area | Common research grade; exact threshold depends on application |
| Sample preparation | Dissolve in water/acetonitrile with acid | Formic acid or trifluoroacetic acid often used |
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
In addition to killing bacteria directly they have been demonstrated to have a number of immunomodulatory functions that may be involved in the clearance of infection, including the ability to alter host gene expression, act as chemokines and/or induce chemokine production, inhibiting lipopolysaccharide induced pro-inflammatory cytokine production, promoting wound healing, and modulating the responses of dendritic cells and cells of the adaptive immune response. Animal models indicate that host defense peptides are crucial for both prevention and clearance of infection. It appears as though many peptides initially isolated as and termed "antimicrobial peptides" have been shown to have more significant alternative functions in vivo (e.g. hepcidin). Dusquetide for example is an immunomodulator that acts through p62, a protein involved in toll like receptor based signalling of infection. The peptide is being examined in a Phase III clinical trial by Soligenix (SGNX) to ascertain if it can assist in repair of radiation-induced damage to oral mucosa arising during cancer radiotherapy of the head and neck.
In organic chemistry, an amide, also known as an organic amide or a carboxamide, is a compound with the general formula R−C(=O)−NR′R″, where R, R', and R″ represent any group, typically organyl groups or hydrogen atoms. The amide functional group plays an important role in the chemistry of life where, as peptide bonds, they link amino acids together to form proteins. Amides can be viewed as a derivative of a carboxylic acid (R−C(=O)−OH) with the hydroxyl group (−OH) replaced by an amino group (−NR′R″); or, equivalently, an acyl (alkanoyl) group (R−C(=O)−) joined to an amino group. Common amides are formamide (H−C(=O)−NH2), acetamide (H3C−C(=O)−NH2), benzamide (C6H5−C(=O)−NH2), and dimethylformamide (H−C(=O)−N(−CH3)2). Amides are qualified as primary, secondary, and tertiary according to the number of acyl groups bounded to the nitrogen atom.
A 15-hydroxyicosatetraenoate dehydrogenase metabolizes 15-hydroxyicosatetraenoic acid (i.e. 15(S)-hydroxy-5Z,8Z,11Z,13E-eicosatetraenoic acid or 15-HETE) to its 15-keto analog, 15-oxo-ETE, using NAD+ and NADH rather than NADP+ and NADPH as its co-factors. 15-Oxo-ETE appears to have a somewhat different spectrum of activities than its precursor, 15-HETE (see 15-Hydroxyicosatetraenoic acid
Sources: en.wikipedia.org
In botany, apical dominance is the phenomenon whereby the main, central stem of the plant is dominant over (i.e., grows more strongly than) other side stems; on a branch the main stem of the branch is further dominant over its own side twigs. Plant physiology describes apical dominance as the control exerted by the terminal bud (and shoot apex) over the outgrowth of lateral buds.
Alexandra C. Newton is a Canadian and American biochemist. She is a Distinguished Professor of pharmacology at the University of California, San Diego. Newton runs a multidisciplinary Protein kinase C and Cell signaling biochemistry and cell biology research group in the School of Medicine, investigating molecular mechanisms of signal transduction in the Phospholipase C (PLC) and Phosphoinositide 3-kinase (PI3 kinase, or PI3-K) signaling pathways. She has been continuously funded by the US National Institutes of Health since 1988. Newton was born in Cape Town, South Africa, and was schooled in Vancouver, Athens, and Aix-en-Provence. She graduated in 1980 from the Simon Fraser University in Canada, where she was awarded a 1st-class honours degree in biochemistry and French literature. She received her PhD in chemistry in 1986 from Stanford University, working with Wray H. Huestis on a thesis examining band 3, a red cell membrane protein.
In the laboratory it is a common precipitant and cryoprotectant in protein crystallography. Since hexylene glycol is compatible with polar and nonpolar molecules, it competes with the solvent in a crystallography experiment causing the protein to precipitate. Hexylene glycol is so effective in protein crystallography because its amphiphilic nature and small, flexible structure allows it to bind to many different locations on a protein secondary structure including alpha helices and beta sheets. When hexylene glycol binds to these different locations, water is removed and the protein crystals anneal, which prevents ice formation during cryocrystallography techniques. Incorporation of hexylene glycol into solution has been known to improve the resolution of X-ray diffraction making protein structures easily identifiable. Additionally hexylene glycol is not a strong denaturing agent and thus does not significantly alter the structure of a protein during the crystallography procedure. Hexylene glycol is also used as a lubricant for polishing specimens in metallography. Like related diols, it forms borate esters.
Sources: en.wikipedia.org
It usually refers to the relative area of the main peak in a chromatographic separation, such as RP-HPLC. It estimates the proportion of UV-absorbing material in that peak, not the absolute mass fraction of the target peptide. Different methods can give different percentages.
HPLC separates and quantifies components, while mass spectrometry identifies molecular masses. Together they can show whether a main peak has the expected mass and whether other peaks correspond to related peptide variants. This combination is more informative than either method alone.
Higher purity reduces the proportion of detectable related impurities, which can matter for research reproducibility. However, purity value alone does not establish identity, biological activity, or safety. The appropriate purity depends on the intended use and the sensitivity of the assay.
Purity percentages vary because each laboratory uses its own column, mobile phase, gradient, detection wavelength, and integration settings. A 95% value from one method may not equal 95% from another method. Comparative assessment requires the same validated procedure or an orthogonal cross-check.