reversed-phase HPLC is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-11-11. Where a claim depends on a specific study, the study is described rather than over-claimed.
Regulatory status differs sharply between jurisdictions. In Russia the peptide is registered as a prescription nasal preparation, while agencies such as the United States Food and Drug Administration have not approved it for any indication. Products sold elsewhere are typically labeled for laboratory research only, and such labels shift responsibility for safe handling to the purchaser. Because the same name covers pharmaceutical-grade nasal drops and bulk research powder, identity and purity documentation becomes the main practical concern when comparing sources.
Semax is a synthetic seven-amino-acid peptide whose sequence extends the ACTH(4-10) fragment with a C-terminal proline-glycine-proline tripeptide. The commonly cited sequence is Met-Glu-His-Phe-Pro-Gly-Pro, giving a molecular formula near C37H51N9O10S and a molecular weight close to 813.9 g/mol. It belongs to the broader class of synthetic ACTH fragments studied for central nervous system effects rather than for adrenal steroid stimulation. In practice the material appears as a lyophilized white powder for laboratory work or as a dilute saline solution in clinical settings.
Development is attributed to researchers at the Institute of Molecular Genetics in Moscow during the early 1980s, building on earlier Soviet work with ACTH fragments. Russian regulatory approval followed for intranasal use, and the compound has remained commercially available there for decades. Most published human data originate from Russian and, later, some Eastern European clinical reports, which are not always accessible in English translation. Outside that region the material is generally handled as a research chemical rather than a licensed medicine.
Claims about enhanced focus, memory, or mood in healthy people rest mostly on anecdotal reports and community discussion rather than on controlled data. It remains unclear whether any cognitive benefit observed in patients recovering from brain injury would extend to uninjured users. Dose-response relationships, long-term safety, and interactions with other drugs are not well characterized in the peer-reviewed literature. Questions about optimal route of administration and treatment duration likewise remain open.
Semax binds to melanocortin receptors and is thought to influence neuronal survival and plasticity rather than to act through the adrenal axis. Laboratory work has shown increased expression of brain-derived neurotrophic factor and nerve growth factor in treated tissue. Changes in c-Fos, a marker of neuronal activation, have also been reported. Because the peptide is rapidly degraded by peptidases, its effects are generally attributed to downstream signaling cascades rather than to sustained receptor occupancy.
Published studies are dominated by animal models of stroke, ischemia, and cognitive impairment, with a smaller number of human trials conducted in Russia. Many of the human reports are small, single-center, and published in Russian-language journals, which limits independent scrutiny. Outcome measures vary between studies and often rely on clinician-rated scales rather than objective biomarkers. Systematic reviews have noted the methodological weaknesses and called for larger, preregistered trials before firm conclusions can be drawn.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide (ACTH fragment analog) | Not a steroid; does not belong to the melanocortin agonist drugs by marketing category |
| Molecular formula | C37H51N9O10S (commonly cited) | Reported values vary slightly with salt and counter-ion content |
| Appearance | White to off-white lyophilized powder | A single batch may appear as a loose cake or fluffy solid |
| Solubility | Freely soluble in water and aqueous buffer | Stock solutions are usually prepared in sterile water or saline |
| Typical storage | −20 °C or below, desiccated and protected from light | Seal opened vials promptly to limit moisture uptake |
The compound was developed in the 1980s at the Institute of Molecular Genetics in Moscow, where it emerged from research on short ACTH fragments and their effects on the central nervous system. Russian pharmaceutical listings describe it as a nootropic and neuroprotective agent, most often formulated as nasal drops. It is not a marketed medicine in the United States or the European Union, and no pharmacopoeial monograph covers it. Consequently, most published clinical experience with the substance originates from a small number of research centres, mainly in Russia and neighbouring countries.
Pharmacological accounts link semax to melanocortin signalling and to modulation of neurotrophic factor expression, particularly brain-derived neurotrophic factor and nerve growth factor. Much of this evidence comes from rodent studies using intranasal delivery, a route chosen because it allows peptides to reach the central nervous system with limited systemic exposure. Whether the same mechanisms operate in humans at comparable magnitude remains an open question. The precise receptor or receptors responsible for the reported behavioural and neuroprotective effects have not been conclusively identified.
Clinical reports describe use in ischaemic stroke, transient ischaemic attack, optic nerve conditions, and cognitive complaints, but most of these studies are small and were conducted in a single region. Systematic reviews have generally described the evidence base as limited in size and variable in methodological quality. Randomised controlled data suitable for international regulatory assessment are scarce. As a result, major treatment guidelines outside Russia do not include the peptide, and interest in it remains largely research-driven rather than routine clinical.
Identity and purity are commonly assessed by reversed-phase high-performance liquid chromatography, with ultraviolet detection near 214 nanometers for the peptide backbone. Mass spectrometry, either electrospray or matrix-assisted laser desorption, confirms molecular mass and detects truncation or modification products. Amino acid analysis can verify composition. Because the sequence contains no strongly absorbing aromatic residue apart from phenylalanine, detection wavelengths are chosen carefully. Purity values above 95 percent are typical for research-grade material.
Quality documentation for research-grade peptide usually includes a certificate of analysis stating purity, identity, and residual counterion content. Batch-to-batch variation in purity and salt form is a recognized issue, and comparisons across suppliers require attention to the exact counterion, for example acetate versus trifluoroacetate. Sequence verification by tandem mass spectrometry provides stronger evidence than a single mass measurement. For any study reporting biological results, the analytical method and the measured purity should be stated explicitly. Independent verification of supplier claims is considered good practice.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It corresponds to the ACTH(4-7) fragment extended at the C-terminus by a Pro-Gly-Pro tripeptide, an addition intended to slow enzymatic breakdown. The molecular formula is C37H51N9O10S and the molecular mass is approximately 814 daltons. In the literature it is often described as an ACTH(4-10) analog, although that label reflects a naming convention as much as a precise structural relationship. The compound was developed in Russia and remains most closely associated with that research tradition.
Laboratory descriptions of the material are consistent across suppliers. It appears as a white to off-white lyophilized powder that dissolves readily in water and in polar organic solvents such as dimethyl sulfoxide. Aqueous solutions are clear and colorless at low concentrations. Because the peptide contains methionine, oxidation at the sulfur atom is a recognized degradation pathway, and handling notes usually call for protected, desiccated storage. Reported purity for research-grade lots is generally above 95 percent as measured by reversed-phase high-performance liquid chromatography.
The compound is registered in Russia as a pharmaceutical product, most commonly formulated as a nasal solution, and has been used in that setting since the 1990s. Outside that jurisdiction it is generally handled as a research chemical rather than an approved medicine. Regulatory status therefore differs sharply between countries, and material sold internationally may not correspond to the Russian pharmaceutical formulation. Documentation with commercial samples is typically limited to a certificate of analysis covering purity and identity, not clinical status or local legal classification.
Stability depends heavily on physical state. Lyophilized powder held dry, cold and dark retains its content over long periods, whereas dissolved peptide begins to change within days at room temperature. The most cited degradation route is oxidation of the methionine residue, which converts the peptide to a sulfoxide form that elutes differently on chromatography. Hydrolysis of amide bonds and adsorption onto container walls contribute smaller losses. Buffers that exclude oxygen from the headspace slow the oxidation pathway, but no single condition prevents all change indefinitely.
Practical handling follows from those properties. Bulk material is best divided into single-use portions soon after receipt, because each thaw exposes the whole container to moisture and temperature cycling. Vials should be allowed to reach room temperature before opening to prevent condensation on the powder. Low-binding plasticware reduces loss of dilute solutions, and sterile filtration is used when a preparation must remain free of microbial growth. Records of batch number, reconstitution date and storage history are what allow a later analytical result to be interpreted meaningfully.
== Aftermath == The newly elected Volkskammer was constituted on 5 April 1990, and elected Sabine Bergmann-Pohl of the CDU as its president. As the State Council of the GDR was dissolved at the same time, she became East Germany's interim head of state. Four days later, after protracted negotiations, Lothar de Maizière announced the formation of a grand coalition between the Alliance for Germany, SPD, and BFD. On 12 April 1990, he was elected Prime Minister of the GDR by the Volkskammer with 265 votes in favour, 108 against, and 9 abstentions. The new cabinet was also confirmed. The partners in the coalition commanded a two-thirds supermajority in the Volkskammer, making it an übergroß coalition with enough seats to pass amendments to the constitution. The new parliament quickly passed several pieces of major legislation, including a new law regarding local government on 17 May, a law ratifying the monetary, economic, and social union with the Federal Republic of Germany on 18 May (which became effective on 1 July), and constitutional amendments on 17 June. On 21 June, the Volkskammer formed a special committee, chaired by Joachim Gauck, to control the dissolution of the Ministry for State Security (Stasi). On 20 September 1990, the Volkskammer voted 299–80 to accept the Treaty on the Final Settlement with Respect to Germany, which had earlier been approved in a 442–47 vote by the West German Bundestag.
=== Systemicity and translocation === Insecticides may be systemic or non-systemic (contact insecticides). Systemic insecticides penetrate into the plant and move (translocate) inside the plant. Translocation may be upward in the xylem, or downward in the phloem or both. Systemicity is a prerequisite for the pesticide to be used as a seed-treatment. Contact insecticides (non-systemic insecticides) remain on the leaf surface and act through direct contact with the insect. Insects feed from various compartments in the plant. Most of the major pests are either chewing insects or sucking insects. Chewing insects, such as caterpillars, eat whole pieces of leaf. Sucking insects use feeding tubes to feed from phloem (e.g. aphids, leafhoppers, scales and whiteflies), or to suck cell contents (e.g. thrips and mites). An insecticide is more effective if it is in the compartment the insect feeds from. The physicochemical properties of the insecticide determine how it is distributed throughout the plant.
== Languages == CBSE offers academic subjects in 40 different languages, which are Arabic, Assamese, Bahasa Melayu, Bengali, Bhutia, Bodo, English, French, German, Gujarati, Gurung, Hindi Course-A, Hindi Course-B, Japanese, Kannada, Kashmiri, Kokborok, Lepcha, Limboo, Malayalam, Meitei (Manipuri), Marathi, Mizo, Nepali, Odia, Persian, Punjabi, Rai, Russian, Sanskrit, Sindhi, Spanish, Sherpa, Tamang, Tamil, Tangkhul, Telugu AP, Telugu Telangana, Thai, Tibetan, Urdu Course A and Urdu Course B.
==== Embryology ==== Cephalopod eggs span a large range of sizes, from 1 to 30 mm in diameter. The fertilised ovum initially divides to produce a disc of germinal cells at one pole, with the yolk remaining at the opposite pole. The germinal disc grows to envelop and eventually absorb the yolk, forming the embryo. The tentacles and arms first appear at the hind part of the body, where the foot would be in other molluscs, and only later migrate towards the head. The funnel of cephalopods develops on the top of their head, whereas the mouth develops on the opposite surface. The early embryological stages are reminiscent of ancestral gastropods and extant Monoplacophora. The shells develop from the ectoderm as an organic framework which is subsequently mineralized. In Sepia, which has an internal shell, the ectoderm forms an invagination whose pore is sealed off before this organic framework is deposited.
== Source == GsMTx-4 was isolated from the venom of Grammostola spatulata. After a blocking effect on mechanosensitive channels of the spider venom was detected in 1996, GsMTx-4 was isolated and identified from the venom later in 2000. Its concentration in the venom is ~2 mM.
Sources: en.wikipedia.org
It is now known that organic compounds can be conductors, semiconductors, and insulators, thus one of the main opportunities in nanomaterials science is to use organic synthesis and molecular design to make electronically useful structures. Structural motifs in these systems include colloids, small crystals, and aggregates on the order of 1-100 nm. By function Nanostructured materials can also be classed according to their functions, for example nanoelectronics and information technology (IT). Lateral dimensions used in information storage are shrinking from the micro- to the nanoscale as fabrication technologies improve. Optical materials are important in the development of miniaturized information storage because light has many advantages for storage and transmission over electronic methods. Quantum dots - most commonly CdSe nanoparticles having diameters of tens of nm, and with protective surface coatings - are notable for their ability to fluoresce over a broad range of the visible spectrum, with the controlling parameter being size. By structure Certain structural classes are especially relevant to nanoscience. As the dimensions of structures become smaller, their surface area-to-volume ratio increases. Much like molecules, nanostructures at small enough scales are essentially "all surface". The mechanical properties of materials are strongly influenced by these surface structures. Fracture strength and character, ductility, and various mechanical moduli all depend on the substructure of the materials over a range of scales.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
junk RNA Any RNA-encoded sequence, especially a transcript, that appears to have no known biological function, or whose function has no positive or a net negative effect on the fitness of the genome from which it is transcribed. Despite remaining untranslated, many non-coding RNAs still serve important functions, whereas junk RNAs are truly useless: often they are the product of accidental transcription of a junk DNA sequence, or they may result from post-transcriptional processing of primary transcripts, as with spliced-out introns. Junk RNA is usually quickly degraded by ribonucleases and other cytoplasmic enzymes.
On 10 January 1973, negotiations broke down when Kissinger demanded the release of all American POWs in North Vietnam once a peace agreement was signed, but offered no guarantees about Viet Cong prisoners being held in South Vietnam. Tho stated: "I cannot accept your proposal. I completely reject it". Tho wanted the release of all prisoners once a peace agreement was signed, which led Kissinger to say this was an unreasonable demand. Tho, who had been tortured as a young man by the French colonial police for advocating Vietnamese independence, shouted: "You have never been a prisoner. You don't understand suffering. It's unfair". Kissinger finally offered the concession that the United States would use "maximum influence" to pressure the South Vietnamese government to release all Viet Cong prisoners within sixty days of a peace agreement being signed. Thiệu once again rejected the peace agreement, only to receive an ultimatum from Nixon: "You must decide now whether you desire to continue our alliance or whether you want me to seek a settlement with the enemy which serves U.S. interests alone". Nixon told Kissinger: "Brutality is nothing. You have never seen it if this son-of-a-bitch doesn't go along, believe me". Nixon's threat served its purpose, and Thiệu reluctantly accepted the peace agreement. On 23 January 1973, at 12:45 pm, Kissinger and Tho signed a peace agreement in Paris that called for the complete withdrawal of all U.S. forces from Vietnam by March in exchange for North Vietnam freeing all the U.S. POWs.
Sources: en.wikipedia.org
=== N05AB Phenothiazines with piperazine structure === N05AB01 Dixyrazine N05AB02 Fluphenazine N05AB03 Perphenazine N05AB04 Prochlorperazine N05AB05 Thiopropazate N05AB06 Trifluoperazine N05AB07 Acetophenazine N05AB08 Thioproperazine N05AB09 Butaperazine N05AB10 Perazine N05AB13 Metofenazate
==== United Kingdom ==== 5-MAPB was originally banned in the UK in June 2013 under a Temporary class drug order. On March 5, 2014, the UK Home Office announced that 5-MAPB would be made a class B drug on 10 June 2014 alongside every other benzofuran entactogen and many structurally related drugs.
==== Adults ==== There are more obese US adults than those who are just overweight. According to a study in The Journal of the American Medical Association (JAMA), in 2008, the obesity rate among adult Americans was estimated at 32.2% for men and 35.5% for women; these rates were roughly confirmed by the CDC again for 2009–2010. A Gallup survey found 41% of U.S. adults, on average, from 2017 to 2021, have characterized themselves as overweight, while the slight majority (53%) have said their weight is about right, and 5% reported they are underweight. Though the rate for women has held steady over the previous decade, the obesity rate for men continued to increase between 1999 and 2008, according to the JAMA study notes. Moreover, "The prevalence of obesity for adults aged 20 to 74 years increased by 7.9 percentage points for men and by 8.9 percentage points for women between 1976–1980 and 1988–1994, and subsequently by 7.1 percentage points for men and by 8.1 percentage points for women between 1988–1994 and 1999–2000." According to the CDC, obesity has consistently remained the highest among middle-age adults since 2011. In the most recent update, 44.8% of Americans in their forties and fifties qualified as obese; meanwhile 40% of young adults and 42.4% of older adults were obese.
Sources: en.wikipedia.org
It is a short synthetic peptide built from seven amino acids: methionine, glutamic acid, histidine, phenylalanine and three prolines. The sequence derives from the 4-10 fragment of adrenocorticotropic hormone with an added proline-glycine-proline tail. No plant or animal extract is involved; the material is produced by solid-phase peptide synthesis.
It was developed in the Soviet Union during the early 1980s by groups at the Institute of Molecular Genetics in Moscow. Russian approval for intranasal use followed, and it has been marketed there since. Western laboratories encountered it mainly through translated literature and, later, through online research-chemical trade.
It holds a Russian registration as a prescription nasal product but has no approval from the European Medicines Agency or the United States Food and Drug Administration. Buyers outside Russia usually receive material sold strictly for laboratory research. That distinction matters because research-grade and pharmaceutical-grade products carry different documentation and testing expectations.
It is associated with the melanocortin receptor family, particularly subtypes found in the central nervous system. This interaction is separate from the adrenal pathway activated by full-length ACTH.